PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 294aa    MW: 31906.3 Da    PI: 9.3638
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032108genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.63.3e-181152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i n+s r+ t+ kR++g++KK +ELS+LCd++++ i++++ +
  Lus10032108 11 IANDSARKATYKKRKKGLMKKVSELSTLCDIQACAIVYGPYD 52
                 89*************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.7E-24160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.708149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-25297IPR002100Transcription factor, MADS-box
CDDcd002663.99E-21286No hitNo description
PRINTSPR004043.3E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-171155IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MTRKKVKLAY IANDSARKAT YKKRKKGLMK KVSELSTLCD IQACAIVYGP YDTQPETWPS  60
TPAGVHQVLS RFRKVPQMEQ CKKMVNQEKF LGERIKKAAE QLRKQKRDND EKMVQNALFE  120
CLTGRISLQS LTLGDLDVIA RAVDQQIKDV DRKLTEIARK GGGGGGGGST TAANGVNNLE  180
GPLQMMTPAN GGGMVGPAKE EFMENVNDTL QRQLWFMEMM NSNAPAPLTA VEQQQMGFMG  240
GEMMMNNVAA EGGGGGGGGF GEGSSSNWVG NNGVINGNNN SNPFWSGNYH CYH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIANDSARKATYKKRK
22125KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382260.11e-74hypothetical protein POPTR_0005s00420g
SwissprotQ9FJK32e-54AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLU5GF691e-74U5GF69_POPTR; Uncharacterized protein
STRINGPOPTR_0005s00420.13e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-53AGAMOUS-like 80